Paralogue Annotation for ANK2 residue 3242

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3242
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3242

No paralogue variants have been mapped to residue 3242 for ANK2.



ANK2PDSSEPAVQVQLDFSTLTRSVYSDRGDDSP>D<SSPEEQKSVIEIPTAPMENVPFTESKSKIP3272
ANK1------------------------------>-<------------------------------
ANK3TANSQMGVRPHEK-HDFQKDNFNNN--NNL>D<SSTIQTDNI-------MSNIVLTEH--SAP3814
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D3242Ec.9726T>G Putative BenignSIFT:
Polyphen: benign
p.D3242Vc.9725A>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging