Paralogue Annotation for ANK2 residue 3248

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3248
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3248

No paralogue variants have been mapped to residue 3248 for ANK2.



ANK2AVQVQLDFSTLTRSVYSDRGDDSPDSSPEE>Q<KSVIEIPTAPMENVPFTESKSKIPVRTMPT3278
ANK1------------------------------>-<------------------------------
ANK3GVRPHEK-HDFQKDNFNNN--NNLDSSTIQ>T<DNI-------MSNIVLTEH--SAPTCTTEK3820
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q3248Ec.9742C>G Putative BenignSIFT: tolerated
Polyphen: benign
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510