Paralogue Annotation for ANK2 residue 343

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 343
Reference Amino Acid: D - Aspartate
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 343

No paralogue variants have been mapped to residue 343 for ANK2.



ANK2QVVELLLERGAPLLARTKNGLSPLHMAAQG>D<HVECVKHLLQHKAPVDDVTLDYLTALHVAA373
ANK1RISEILLDHGAPIQAKTKNGLSPIHMAAQG>D<HLDCVRLLLQYDAEIDDITLDHLTPLHVAA346
ANK3QVVEMLLDRAAPILSKTKNGLSPLHMATQG>D<HLNCVQLLLQHNVPVDDVTNDYLTALHVAA375
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D343Ec.1029C>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging