Paralogue Annotation for ANK2 residue 3523

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3523
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3523

No paralogue variants have been mapped to residue 3523 for ANK2.



ANK2HSVPEDIFDTRPIWDESIETLIERIPDENG>H<DHAEDPQDEQERIEERLAYIADHLGFSWTE3553
ANK1------------------------------>-<----GSLSGTEQAEMKMAVISEHLGLSWAE1420
ANK3SVTTKSARDKKTEAA-PLKSKSEKAGSEKR>S<SRRTGPQSPCERTDIRMAIVADHLGLSWTE4107
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H3523Rc.10568A>G UnknownSIFT:
Polyphen:
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510