Paralogue Annotation for ANK2 residue 3536

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3536
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3536

No paralogue variants have been mapped to residue 3536 for ANK2.



ANK2WDESIETLIERIPDENGHDHAEDPQDEQER>I<EERLAYIADHLGFSWTELARELDFTEEQIH3566
ANK1----------------------GSLSGTEQ>A<EMKMAVISEHLGLSWAELARELQFSVEDIN1433
ANK3AA-PLKSKSEKAGSEKRSSRRTGPQSPCER>T<DIRMAIVADHLGLSWTELARELNFSVDEIN4120
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I3536Tc.10607T>C Putative BenignSIFT: tolerated
Polyphen: benign