Paralogue Annotation for ANK2 residue 354

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 354
Reference Amino Acid: H - Histidine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 354

No paralogue variants have been mapped to residue 354 for ANK2.



ANK2PLLARTKNGLSPLHMAAQGDHVECVKHLLQ>H<KAPVDDVTLDYLTALHVAAHCGHYRVTKLL384
ANK1PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQ>Y<DAEIDDITLDHLTPLHVAAHCGHHRVAKVL357
ANK3PILSKTKNGLSPLHMATQGDHLNCVQLLLQ>H<NVPVDDVTNDYLTALHVAAHCGHYKVAKVL386
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H354Yc.1060C>T Putative BenignSIFT: tolerated
Polyphen: benign