Paralogue Annotation for ANK2 residue 3574

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3574
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3574

No paralogue variants have been mapped to residue 3574 for ANK2.



ANK2ADHLGFSWTELARELDFTEEQIHQIRIENP>N<SLQDQSHALLKYWLERDGKHATDTNLVECL3604
ANK1SEHLGLSWAELARELQFSVEDINRIRVENP>N<SLLEQSVALLNLWVIREGQNANMENLYTAL1471
ANK3ADHLGLSWTELARELNFSVDEINQIRVENP>N<SLISQSFMLLKKWVTRDGKNATTDALTSVL4158
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N3574Sc.10721A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging