Paralogue Annotation for ANK2 residue 3587

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3587
Reference Amino Acid: W - Tryptophan
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3587

No paralogue variants have been mapped to residue 3587 for ANK2.



ANK2ELDFTEEQIHQIRIENPNSLQDQSHALLKY>W<LERDGKHATDTNLVECLTKINRMDIVHLME3617
ANK1ELQFSVEDINRIRVENPNSLLEQSVALLNL>W<VIREGQNANMENLYTALQSIDRGEIVNMLE1484
ANK3ELNFSVDEINQIRVENPNSLISQSFMLLKK>W<VTRDGKNATTDALTSVLTKINRIDIVTLLE4171
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.W3587Rc.10759T>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: benign
ReportsInherited ArrhythmiaLQTS Analysis of ankyrin-B gene mutations in patients with long QT syndrome. Nan Fang Yi Ke Da Xue Xue Bao. 2006 26(7):901-3, 909. 16864073