Paralogue Annotation for ANK2 residue 3594

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3594
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3594

No paralogue variants have been mapped to residue 3594 for ANK2.



ANK2QIHQIRIENPNSLQDQSHALLKYWLERDGK>H<ATDTNLVECLTKINRMDIVHLMETNT-EPL3623
ANK1DINRIRVENPNSLLEQSVALLNLWVIREGQ>N<ANMENLYTALQSIDRGEIVNMLEGSGRQSR1491
ANK3EINQIRVENPNSLISQSFMLLKKWVTRDGK>N<ATTDALTSVLTKINRIDIVTLLEGP-----4173
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H3594Qc.10782T>G Putative BenignSIFT:
Polyphen: benign