Paralogue Annotation for ANK2 residue 3626

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3626
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3626

No paralogue variants have been mapped to residue 3626 for ANK2.



ANK2DTNLVECLTKINRMDIVHLMETNT-EPLQE>R<ISHSYAEIEQTITLDHSEGFSVLQEELCT-3655
ANK1MENLYTALQSIDRGEIVNMLEGSGRQSRNL>K<PDRRHTDRDYSLSPSQMNGYSSLQDELLSP1524
ANK3TDALTSVLTKINRIDIVTLLEGP------->-<------------------------------4173
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3626Cc.10876C>T Putative BenignSIFT: deleterious
Polyphen: benign
p.R3626Lc.10877G>T Putative BenignSIFT: deleterious
Polyphen: benign
p.R3626Hc.10877G>A Putative BenignSIFT:
Polyphen: