Paralogue Annotation for ANK2 residue 3674

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3674
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3674

No paralogue variants have been mapped to residue 3674 for ANK2.



ANK2------------AQHKQKEEQAVSKESETC>D<HPPIVSEEDISVGYSTFQDG----------3694
ANK1EVAVLDAIPLAATEHDTMLEMSDMQVWSAG>L<TPSLVTAEDSSLECSKAEDSDATGHEWKLE1603
ANK3----------------------------IF>D<YGNISGTRSFADENNVFHDP----------4196
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D3674Nc.11020G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging