Paralogue Annotation for ANK2 residue 377

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 377
Reference Amino Acid: H - Histidine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 377

No paralogue variants have been mapped to residue 377 for ANK2.



ANK2CVKHLLQHKAPVDDVTLDYLTALHVAAHCG>H<YRVTKLLLDKRANPNARALNGFTPLHIACK407
ANK1CVRLLLQYDAEIDDITLDHLTPLHVAAHCG>H<HRVAKVLLDKGAKPNSRALNGFTPLHIACK380
ANK3CVQLLLQHNVPVDDVTNDYLTALHVAAHCG>H<YKVAKVLLDKKANPNAKALNGFTPLHIACK409
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H377Yc.1129C>T Putative BenignSIFT:
Polyphen: probably damaging