Paralogue Annotation for ANK2 residue 3787

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3787
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3787

No paralogue variants have been mapped to residue 3787 for ANK2.



ANK2SSPSKTP--EEVSTPAEEEKLYLQTPTSSE>R<GGSPIIQEPEEP-------------SEHRE3804
ANK1AAQGSWQ--EEV---------T-QGPHSF->-<QGTSTMTEGLEPGGSQEYEKVLVSVSEHTW1762
ANK3EAKTKSYFPESQNDVGKQS--T-KETLKPK>I<HGSGHVEEPASP-------------LAAYQ4304
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3787Qc.11360G>A Putative BenignSIFT:
Polyphen: benign
p.R3787Wc.11359C>T Putative BenignSIFT: tolerated
Polyphen: benign