Paralogue Annotation for ANK2 residue 3789

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3789
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3789

No paralogue variants have been mapped to residue 3789 for ANK2.



ANK2PSKTP--EEVSTPAEEEKLYLQTPTSSERG>G<SPIIQEPEEP-------------SEHREES3806
ANK1QGSWQ--EEV---------T-QGPHSF--Q>G<TSTMTEGLEPGGSQEYEKVLVSVSEHTWTE1764
ANK3KTKSYFPESQNDVGKQS--T-KETLKPKIH>G<SGHVEEPASP-------------LAAYQKS4306
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G3789Ac.11366G>C BenignSIFT: tolerated
Polyphen: benign