Paralogue Annotation for ANK2 residue 3798

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3798
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3798

No paralogue variants have been mapped to residue 3798 for ANK2.



ANK2VSTPAEEEKLYLQTPTSSERGGSPIIQEPE>E<P-------------SEHREESSPRKTSLVI3815
ANK1V---------T-QGPHSF--QGTSTMTEGL>E<PGGSQEYEKVLVSVSEHTWTEQPEAESSQA1773
ANK3QNDVGKQS--T-KETLKPKIHGSGHVEEPA>S<P-------------LAAYQKSLEETSKLII4315
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E3798Dc.11394G>T Putative BenignSIFT:
Polyphen: benign
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510