Paralogue Annotation for ANK2 residue 388

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 388
Reference Amino Acid: R - Arginine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 388

No paralogue variants have been mapped to residue 388 for ANK2.



ANK2VDDVTLDYLTALHVAAHCGHYRVTKLLLDK>R<ANPNARALNGFTPLHIACKKNRIKVMELLV418
ANK1IDDITLDHLTPLHVAAHCGHHRVAKVLLDK>G<AKPNSRALNGFTPLHIACKKNHVRVMELLL391
ANK3VDDVTNDYLTALHVAAHCGHYKVAKVLLDK>K<ANPNAKALNGFTPLHIACKKNRIKVMELLL420
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R388Kc.1163G>A Putative BenignSIFT: tolerated
Polyphen: benign