Paralogue Annotation for ANK2 residue 3881

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3881
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3881

No paralogue variants have been mapped to residue 3881 for ANK2.



ANK2YIDEHGHTVVKKVTRKIIRRYVSSE---GT>E<KEEIMVQGMPQEPVNIEEGDGYSKVIK-RV3910
ANK1FTDEQGNIVTKKIIRKVVRQIDLSSADAAQ>E<HEEVELRGSGLQPDLI-EGRKGAQIVKRAS1874
ANK3----------------------------GS>E<Q--------------K-QGEGFKVKTK-KE4367
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E3881Dc.11643G>C UnknownSIFT:
Polyphen:
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510