Paralogue Annotation for ANK2 residue 404

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 404
Reference Amino Acid: I - Isoleucine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 404

No paralogue variants have been mapped to residue 404 for ANK2.



ANK2HCGHYRVTKLLLDKRANPNARALNGFTPLH>I<ACKKNRIKVMELLVKYGASIQAITESGLTP434
ANK1HCGHHRVAKVLLDKGAKPNSRALNGFTPLH>I<ACKKNHVRVMELLLKTGASIDAVTESGLTP407
ANK3HCGHYKVAKVLLDKKANPNAKALNGFTPLH>I<ACKKNRIKVMELLLKHGASIQAVTESGLTP436
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I404Vc.1210A>G UnknownSIFT:
Polyphen: possibly damaging