Paralogue Annotation for ANK2 residue 421

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 421
Reference Amino Acid: G - Glycine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 421

No paralogue variants have been mapped to residue 421 for ANK2.



ANK2PNARALNGFTPLHIACKKNRIKVMELLVKY>G<ASIQAITESGLTPIHVAAFMGHLNIVLLLL451
ANK1PNSRALNGFTPLHIACKKNHVRVMELLLKT>G<ASIDAVTESGLTPLHVASFMGHLPIVKNLL424
ANK3PNAKALNGFTPLHIACKKNRIKVMELLLKH>G<ASIQAVTESGLTPIHVAAFMGHVNIVSQLM453
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G421Ac.1262G>C Putative BenignSIFT: deleterious
Polyphen: possibly damaging