Paralogue Annotation for ANK2 residue 475

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 475
Reference Amino Acid: G - Glycine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 475

No paralogue variants have been mapped to residue 475 for ANK2.



ANK2NIVLLLLQNGASPDVTNIRGETALHMAARA>G<QVEVVRCLLRNGALVDARAREEQTPLHIAS505
ANK1PIVKNLLQRGASPNVSNVKVETPLHMAARA>G<HTEVAKYLLQNKAKVNAKAKDDQTPLHCAA478
ANK3NIVSQLMHHGASPNTTNVRGETALHMAARS>G<QAEVVRYLVQDGAQVEAKAKDDQTPLHISA507
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G475Rc.1423G>A Other Cardiac PhenotypeSIFT: deleterious
Polyphen: probably damaging
ReportsOther Cardiac Phenotype Association of torsades de pointes with novel and known single nucleotide polymorphisms in long QT syndrome genes. Am Heart J. 2006 152(6):1116-22. 17161064