Paralogue Annotation for ANK2 residue 491

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 491
Reference Amino Acid: D - Aspartate
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 491

No paralogue variants have been mapped to residue 491 for ANK2.



ANK2NIRGETALHMAARAGQVEVVRCLLRNGALV>D<ARAREEQTPLHIASRLGKTEIVQLLLQHMA521
ANK1NVKVETPLHMAARAGHTEVAKYLLQNKAKV>N<AKAKDDQTPLHCAARIGHTNMVKLLLENNA494
ANK3NVRGETALHMAARSGQAEVVRYLVQDGAQV>E<AKAKDDQTPLHISARLGKADIVQQLLQQGA523
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D491Nc.1471G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging