Paralogue Annotation for ANK2 residue 532

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 532
Reference Amino Acid: T - Threonine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 532

No paralogue variants have been mapped to residue 532 for ANK2.



ANK2HIASRLGKTEIVQLLLQHMAHPDAATTNGY>T<PLHISAREGQVDVASVLLEAGAAHSLATKK562
ANK1HCAARIGHTNMVKLLLENNANPNLATTAGH>T<PLHIAAREGHVETVLALLEKEASQACMTKK535
ANK3HISARLGKADIVQQLLQQGASPNAATTSGY>T<PLHLSAREGHEDVAAFLLDHGASLSITTKK564
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T532Ic.1595C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging