Paralogue Annotation for ANK2 residue 558

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 558
Reference Amino Acid: L - Leucine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 558

No paralogue variants have been mapped to residue 558 for ANK2.



ANK2TNGYTPLHISAREGQVDVASVLLEAGAAHS>L<ATKKGFTPLHVAAKYGSLDVAKLLLQRRAA588
ANK1TAGHTPLHIAAREGHVETVLALLEKEASQA>C<MTKKGFTPLHVAAKYGKVRVAELLLERDAH561
ANK3TSGYTPLHLSAREGHEDVAAFLLDHGASLS>I<TTKKGFTPLHVAAKYGKLEVANLLLQKSAS590
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L558Sc.1673T>C Putative BenignSIFT:
Polyphen: probably damaging