Paralogue Annotation for ANK2 residue 566

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 566
Reference Amino Acid: P - Proline
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 566

No paralogue variants have been mapped to residue 566 for ANK2.



ANK2ISAREGQVDVASVLLEAGAAHSLATKKGFT>P<LHVAAKYGSLDVAKLLLQRRAAADSAGKNG596
ANK1IAAREGHVETVLALLEKEASQACMTKKGFT>P<LHVAAKYGKVRVAELLLERDAHPNAAGKNG569
ANK3LSAREGHEDVAAFLLDHGASLSITTKKGFT>P<LHVAAKYGKLEVANLLLQKSASPDAAGKSG598
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P566Sc.1696C>T Putative BenignSIFT:
Polyphen: probably damaging