Paralogue Annotation for ANK2 residue 571

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 571
Reference Amino Acid: A - Alanine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 571

No paralogue variants have been mapped to residue 571 for ANK2.



ANK2GQVDVASVLLEAGAAHSLATKKGFTPLHVA>A<KYGSLDVAKLLLQRRAAADSAGKNGLTPLH601
ANK1GHVETVLALLEKEASQACMTKKGFTPLHVA>A<KYGKVRVAELLLERDAHPNAAGKNGLTPLH574
ANK3GHEDVAAFLLDHGASLSITTKKGFTPLHVA>A<KYGKLEVANLLLQKSASPDAAGKSGLTPLH603
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A571Vc.1712C>T Putative BenignSIFT:
Polyphen: probably damaging