Paralogue Annotation for ANK2 residue 589

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 589
Reference Amino Acid: A - Alanine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 589

No paralogue variants have been mapped to residue 589 for ANK2.



ANK2ATKKGFTPLHVAAKYGSLDVAKLLLQRRAA>A<DSAGKNGLTPLHVAAHYDNQKVALLLLEKG619
ANK1MTKKGFTPLHVAAKYGKVRVAELLLERDAH>P<NAAGKNGLTPLHVAVHHNNLDIVKLLLPRG592
ANK3TTKKGFTPLHVAAKYGKLEVANLLLQKSAS>P<DAAGKSGLTPLHVAAHYDNQKVALLLLDQG621
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A589Gc.1766C>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging