Paralogue Annotation for ANK2 residue 650

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 650
Reference Amino Acid: N - Asparagine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 650

No paralogue variants have been mapped to residue 650 for ANK2.



ANK2ASPHATAKNGYTPLHIAAKKNQMQIASTLL>N<YGAETNIVTKQGVTPLHLASQEGHTDMVTL680
ANK1GSPHSPAWNGYTPLHIAAKQNQVEVARSLL>Q<YGGSANAESVQGVTPLHLAAQEGHAEMVAL653
ANK3ASPHAAAKNGYTPLHIAAKKNQMDIATTLL>E<YGADANAVTRQGIASVHLAAQEGHVDMVSL682
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N650Ic.1949A>T Putative BenignSIFT:
Polyphen: possibly damaging