Paralogue Annotation for ANK2 residue 687

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 687
Reference Amino Acid: N - Asparagine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 687

No paralogue variants have been mapped to residue 687 for ANK2.



ANK2IVTKQGVTPLHLASQEGHTDMVTLLLDKGA>N<IHMSTKSGLTSLHLAAQEDKVNVADILTKH717
ANK1AESVQGVTPLHLAAQEGHAEMVALLLSKQA>N<GNLGNKSGLTPLHLVAQEGHVPVADVLIKH690
ANK3AVTRQGIASVHLAAQEGHVDMVSLLLGRNA>N<VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQ719
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N687Sc.2060A>G Putative BenignSIFT:
Polyphen: probably damaging