Paralogue Annotation for ANK2 residue 690

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 690
Reference Amino Acid: M - Methionine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 690

No paralogue variants have been mapped to residue 690 for ANK2.



ANK2KQGVTPLHLASQEGHTDMVTLLLDKGANIH>M<STKSGLTSLHLAAQEDKVNVADILTKHGAD720
ANK1VQGVTPLHLAAQEGHAEMVALLLSKQANGN>L<GNKSGLTPLHLVAQEGHVPVADVLIKHGVM693
ANK3RQGIASVHLAAQEGHVDMVSLLLGRNANVN>L<SNKSGLTPLHLAAQEDRVNVAEVLVNQGAH722
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M690Vc.2068A>G Putative BenignSIFT:
Polyphen: benign