Paralogue Annotation for ANK2 residue 756

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 756
Reference Amino Acid: A - Alanine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 756

No paralogue variants have been mapped to residue 756 for ANK2.



ANK2KLGYTPLIVACHYGNVKMVNFLLKQGANVN>A<KTKNGYTPLHQAAQQGHTHIINVLLQHGAK786
ANK1RMGYTPLHVASHYGNIKLVKFLLQHQADVN>A<KTKLGYSPLHQAAQQGHTDIVTLLLKNGAS759
ANK3KMGYTPLHVGCHYGNIKIVNFLLQHSAKVN>A<KTKNGYTPLHQAAQQGHTHIINVLLQNNAS788
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A756Tc.2266G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging