Paralogue Annotation for ANK2 residue 777

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 777
Reference Amino Acid: I - Isoleucine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 777

No paralogue variants have been mapped to residue 777 for ANK2.



ANK2LLKQGANVNAKTKNGYTPLHQAAQQGHTHI>I<NVLLQHGAKPNATTANGNTALAIAKRLGYI807
ANK1LLQHQADVNAKTKLGYSPLHQAAQQGHTDI>V<TLLLKNGASPNEVSSDGTTPLAIAKRLGYI780
ANK3LLQHSAKVNAKTKNGYTPLHQAAQQGHTHI>I<NVLLQNNASPNELTVNGNTALGIARRLGYI809
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I777Vc.2329A>G Putative BenignSIFT:
Polyphen: benign