Paralogue Annotation for ANK2 residue 868

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 868
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 868

No paralogue variants have been mapped to residue 868 for ANK2.



ANK2------------GDDTMTGDGGEYLRPEDL>K<ELGDDSLPSSQFLDGMNYLRYSLEGGRSDS898
ANK1------------GEELISFKAERR-DS--->R<D-----------------------VDEEKE842
ANK3LSDGEYISDVEEGEDAMTGDTDKYLGPQDL>K<ELGDDSLPAEGYMG------FSL-GARSAS913
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K868Rc.2603A>G UnknownSIFT:
Polyphen: benign