Paralogue Annotation for ANK2 residue 908

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 908
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 908

No paralogue variants have been mapped to residue 908 for ANK2.



ANK2SQFLDGMNYLRYSLEGGRSDSLRSFSSDRS>H<TLSHASYLRDSAVMDDSVVIPSHQVSTLAK938
ANK1---------------VDEEKELLDFVPKLD>Q<VVESPAIPRIPCAMPETVVIRSEEQEQASK882
ANK3EGYMG------FSL-GARSASLRSFSSDRS>Y<TLNRSSYARDSMMIEELLVPSKEQHLTFTR953
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H908Qc.2724C>A Putative BenignSIFT: tolerated
Polyphen: benign