Paralogue Annotation for ANK2 residue 941

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 941
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 941

No paralogue variants have been mapped to residue 941 for ANK2.



ANK2SHASYLRDSAVMDDSVVIPSHQVSTLAKEA>E<RNSYR-LSWGTENLDNVALSSSPIHSGFLV970
ANK1ESPAIPRIPCAMPETVVIRSEEQEQASKEY>D<EDSLIPSSPATETSDNISPVASPVHTGFLV915
ANK3NRSSYARDSMMIEELLVPSKEQHLTFTREF>D<SDSLRHYSWAADTLDNVNLVSSPIHSGFLV986
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E941Gc.2822A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging