Paralogue Annotation for ANK2 residue 967

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 967
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 967

No paralogue variants have been mapped to residue 967 for ANK2.



ANK2KEAERNSYR-LSWGTENLDNVALSSSPIHS>G<FLVSFMVDARGGAMRGCRHNGLRIIIPPRK997
ANK1KEYDEDSLIPSSPATETSDNISPVASPVHT>G<FLVSFMVDARGGSMRGSRHNGLRVVIPPRT942
ANK3REFDSDSLRHYSWAADTLDNVNLVSSPIHS>G<FLVSFMVDARGGSMRGSRHHGMRIIIPPRK1013
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G967Rc.2899G>C Putative BenignSIFT: deleterious
Polyphen: probably damaging