Paralogue Annotation for KCNE1 residue 66

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 66
Reference Amino Acid: I - Isoleucine
Protein Domain: Transmembrane region


Paralogue Variants mapped to KCNE1 residue 66

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNE4M58VPeriodic paralysis ?Medium9 15611833

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE1.



KCNE1RSSDGKLEALYVLMVLGFFGFFTLGIMLSY>I<RSKKLEHSNDPFNVYIESDA-WQEKDKAYV95
KCNE2ENFY--YVILYLMVMIGMFSFIIVAILVST>V<KSKRREHSNDPYHQYIVED--WQEKYKSQI100
KCNE3PGR-DDNSYMYILFVMFLFAVTVGSLILGY>T<RSRKVDKRSDPYHVYIKN------------98
KCNE4GGSGNGNEYFYILVVMSFYGIFLIGIMLGY>M<KSKRREKKSSLLLLYKDEERLWGEAMKPLP88
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I66Lc.196A>C UnknownSIFT: tolerated
Polyphen: benign