Paralogue Annotation for KCNH2 residue 614

Residue details

Gene: KCNH2
Reference Sequences: LRG: LRG_288, Ensembl variant: ENST00000262186 / ENSP00000262186
Amino Acid Position: 614
Reference Amino Acid: A - Alanine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNH2 residue 614

No paralogue variants have been mapped to residue 614 for KCNH2.



KCNH2------------------LGGPSIKDKYVT>A<LYFTFSSLTSVGFGNVSPNTNSEKIFSICV644
KCNH1-----------S--GK-WEGGPSKNSVYIS>S<LYFTMTSLTSVGFGNIAPSTDIEKIFAVAI483
KCNH3QSDNCSSSSEANGTGLELLGGPSLRSAYIT>S<LYFALSSLTSVGFGNVSANTDTEKIFSICT485
KCNH4-----------------SVGGPSRRSAYIA>A<LYFTLSSLTSVGFGNVCANTDAEKIFSICT459
KCNH5-----------A--GI-WEGGPSKDSLYVS>S<LYFTMTSLTTIGFGNIAPTTDVEKMFSVAM452
KCNH6-----------P------ASGPSVQDKYVT>A<LYFTFSSLTSVGFGNVSPNTNSEKVFSICV496
KCNH7-----------S------SSGPSIKDKYVT>A<LYFTFSSLTSVGFGNVSPNTNSEKIFSICV647
KCNH8-----------------TLGGPSIRSAYIA>A<LYFTLSSLTSVGFGNVSANTDAEKIFSICT454
CNGA1-------------------EFGRLARKYVY>S<LYWSTLTLTTIG-ETPPPVRDSEYVFVVVD381
CNGA2-------------------EYGYLAREYIY>C<LYWSTLTLTTIG-ETPPPVKDEEYLFVIFD356
CNGA3-------------------EHGRLSRKYIY>S<LYWSTLTLTTIG-ETPPPVKDEEYLFVVVD384
CNGA4-------------------GFERLRRQYLY>S<FYFSTLILTTVG-DTPPPAREEEYLFMVGD250
CNGB1----------------------GVGNSYIR>C<YYFAVKTLITIG-GLPDPKTLFEIVFQLLN864
CNGB3----------------------GEGNEYLR>C<YYWAVRTLITIG-GLPEPQTLFEIVFQLLN426
HCN1-------------------VNDSWGKQYSY>A<LFKAMSHMLCIGYGAQAPVSMSDLWITMLS378
HCN2-------------------VNHSWSELYSF>A<LFKAMSHMLCIGYGRQAPESMTDIWLTMLS447
HCN3-------------------VNHSWGRQYSH>A<LFKAMSHMLCIGYGQQAPVGMPDVWLTMLS331
HCN4-------------------VNNSWGKQYSY>A<LFKAMSHMLCIGYGRQAPVGMSDVWLTMLS498
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNH2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A614Vc.1841C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Four novel KVLQT1 and four novel HERG mutations in familial long-QT syndrome. Circulation. 1997 95(3):565-7. 9024139
Inherited ArrhythmiaLQTS Multiple different missense mutations in the pore region of HERG in patients with long QT syndrome. Hum Genet. 1998 102(3):265-72. 9544837
Inherited ArrhythmiaLQTS Genomic structure of three long QT syndrome genes: KVLQT1, HERG, and KCNE1. Genomics. 1998 51(1):86-97. 9693036
Inherited ArrhythmiaLQTS Low penetrance in the long-QT syndrome: clinical impact. Circulation. 1999 99(4):529-33. 9927399
Inherited ArrhythmiaLQTS Romano-Ward long QT syndrome: identification of a HERG mutation in a Taiwanese kindred. J Formos Med Assoc. 1999 98(9):649-52. 10560244
Inherited ArrhythmiaLQTS Increased risk of arrhythmic events in long-QT syndrome with mutations in the pore region of the human ether-a-go-go-related gene potassium channel. Circulation. 2002 105(7):794-9. 11854117
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Most LQT2 mutations reduce Kv11.1 (hERG) current by a class 2 (trafficking-deficient) mechanism. Circulation. 2006 113(3):365-73. 16432067
Inherited ArrhythmiaLQTS Mutation site dependent variability of cardiac events in Japanese LQT2 form of congenital long-QT syndrome. Circ J. 2008 72(5):694-9. 18441445
Inherited ArrhythmiaLQTS Molecular genetic analysis of long QT syndrome in Norway indicating a high prevalence of heterozygous mutation carriers. Scand J Clin Lab Invest. 2008 68(5):362-8. 18752142
Inherited ArrhythmiaLQTS Hydroxyzine, a first generation H(1)-receptor antagonist, inhibits human ether-a-go-go-related gene (HERG) current and causes syncope in a patient with the HERG mutation. J Pharmacol Sci. 2008 108(4):462-71. 19057127
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Latent genetic backgrounds and molecular pathogenesis in drug-induced long-QT syndrome. Circ Arrhythm Electrophysiol. 2009 2(5):511-23. 19843919
Inherited ArrhythmiaLQTS Long QT syndrome-associated mutations in the Per-Arnt-Sim (PAS) domain of HERG potassium channels accelerate channel deactivation. J Biol Chem. 1999 274(15):10113-8. 10187793
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS An in vivo cardiac assay to determine the functional consequences of putative long QT syndrome mutations. Circ Res. 2013 112(5):826-30. doi: 10.1161/CIRCRESAHA.112.300664. 23303164
Unknown Identification of the gene causing long QT syndrome in an Israeli family. Isr Med Assoc J. 2008 10(11):809-11. 19070294
Unknown Modelling the long QT syndrome with induced pluripotent stem cells. Nature. 2011 471(7337):225-9. doi: 10.1038/nature09747. 21240260