Paralogue Annotation for KCNH2 residue 633

Residue details

Gene: KCNH2
Reference Sequences: LRG: LRG_288, Ensembl variant: ENST00000262186 / ENSP00000262186
Amino Acid Position: 633
Reference Amino Acid: N - Asparagine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNH2 residue 633

No paralogue variants have been mapped to residue 633 for KCNH2.



KCNH2GGPSIKDKYVTALYFTFSSLTSVGFGNVSP>N<TNSEKIFSICVMLIGSLMYASIFGNVSAII663
KCNH1GGPSKNSVYISSLYFTMTSLTSVGFGNIAP>S<TDIEKIFAVAIMMIGSLLYATIFGNVTTIF502
KCNH3GGPSLRSAYITSLYFALSSLTSVGFGNVSA>N<TDTEKIFSICTMLIGALMHAVVFGNVTAII504
KCNH4GGPSRRSAYIAALYFTLSSLTSVGFGNVCA>N<TDAEKIFSICTMLIGALMHAVVFGNVTAII478
KCNH5GGPSKDSLYVSSLYFTMTSLTTIGFGNIAP>T<TDVEKMFSVAMMMVGSLLYATIFGNVTTIF471
KCNH6SGPSVQDKYVTALYFTFSSLTSVGFGNVSP>N<TNSEKVFSICVMLIGSLMYASIFGNVSAII515
KCNH7SGPSIKDKYVTALYFTFSSLTSVGFGNVSP>N<TNSEKIFSICVMLIGSLMYASIFGNVSAII666
KCNH8GGPSIRSAYIAALYFTLSSLTSVGFGNVSA>N<TDAEKIFSICTMLIGALMHALVFGNVTAII473
CNGA1EFGRLARKYVYSLYWSTLTLTTIG-ETPPP>V<RDSEYVFVVVDFLIGVLIFATIVGNIGSMI400
CNGA2EYGYLAREYIYCLYWSTLTLTTIG-ETPPP>V<KDEEYLFVIFDFLIGVLIFATIVGNVGSMI375
CNGA3EHGRLSRKYIYSLYWSTLTLTTIG-ETPPP>V<KDEEYLFVVVDFLVGVLIFATIVGNVGSMI403
CNGA4GFERLRRQYLYSFYFSTLILTTVG-DTPPP>A<REEEYLFMVGDFLLAVMGFATIMGSMSSVI269
CNGB1---GVGNSYIRCYYFAVKTLITIG-GLPDP>K<TLFEIVFQLLNYFTGVFAFSVMIGQMRDVV883
CNGB3---GEGNEYLRCYYWAVRTLITIG-GLPEP>Q<TLFEIVFQLLNFFSGVFVFSSLIGQMRDVI445
HCN1VNDSWGKQYSYALFKAMSHMLCIGYGAQAP>V<SMSDLWITMLSMIVGATCYAMFVGHATALI397
HCN2VNHSWSELYSFALFKAMSHMLCIGYGRQAP>E<SMTDIWLTMLSMIVGATCYAMFIGHATALI466
HCN3VNHSWGRQYSHALFKAMSHMLCIGYGQQAP>V<GMPDVWLTMLSMIVGATCYAMFIGHATALI350
HCN4VNNSWGKQYSYALFKAMSHMLCIGYGRQAP>V<GMSDVWLTMLSMIVGATCYAMFIGHATALI517
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNH2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N633Dc.1897A>G Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Denaturing high-performance liquid chromatography screening of the long QT syndrome-related cardiac sodium and potassium channel genes and identification of novel mutations and single nucleotide polymorphisms. J Hum Genet. 2005 50(9):490-6. 16155735
Inherited ArrhythmiaLQTS Functional studies on three novel HCNH2 mutations in Taiwan: identification of distinct mechanisms of channel defect and dissociation between glycosylation defect and assembly defect. Biochem Biophys Res Commun. 2008 373(4):572-8. 18593567
p.N633Ic.1898A>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Long QT syndrome with compound mutations is associated with a more severe phenotype: a Japanese multicenter study. Heart Rhythm. 2010 7(10):1411-8. 20541041
p.N633Sc.1898A>G Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Multiple different missense mutations in the pore region of HERG in patients with long QT syndrome. Hum Genet. 1998 102(3):265-72. 9544837
Inherited ArrhythmiaLQTS Notched T waves on Holter recordings enhance detection of patients with LQt2 (HERG) mutations. Circulation. 2001 103(8):1095-101. 11222472
Inherited ArrhythmiaLQTS Catecholamine-provoked microvoltage T wave alternans in genotyped long QT syndrome. Pacing Clin Electrophysiol. 2003 26(8):1660-7. 12877697
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS [Electrophysiological characterization of long QT syndrome associated mutations V630A and N633S]. Zhonghua Xin Xue Guan Bing Za Zhi. 2006 34(6):523-7. 16842670
Inherited ArrhythmiaLQTS Mutation site dependent variability of cardiac events in Japanese LQT2 form of congenital long-QT syndrome. Circ J. 2008 72(5):694-9. 18441445
Inherited ArrhythmiaLQTS Molecular genetic analysis of long QT syndrome in Norway indicating a high prevalence of heterozygous mutation carriers. Scand J Clin Lab Invest. 2008 68(5):362-8. 18752142
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810
p.N633Kc.1899C>A Inherited ArrhythmiaLQTSSIFT:
Polyphen:
ReportsInherited ArrhythmiaLQTS Genetic characteristics of children and adolescents with long-QT syndrome diagnosed by school-based electrocardiographic screening programs. Circ Arrhythm Electrophysiol. 2014 7(1):107-12. doi: 10.1161/CIRCEP.113.000426. 24363352