Paralogue Annotation for KCNJ2 residue 144

Residue details

Gene: KCNJ2
Reference Sequences: LRG: LRG_328, Ensembl variant: ENST00000535240 / ENSP00000441848
Amino Acid Position: 144
Reference Amino Acid: G - Glycine
Protein Domain: Transmembrane region


Paralogue Variants mapped to KCNJ2 residue 144

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNJ5G151EAldosteronism with bilateral adrenal hyperplasiaHigh9 22203740, 22447138, 22203740, 22308486
KCNJ5G151RAldosteronism, early-onsetHigh9 22308486, 24819081, 22308486
KCNJ11G132DHyperinsulinismHigh9 23345197
KCNJ6G154SKeppen-Lubinsky syndromeHigh9 25620207

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNJ2.



KCNJ2---KEGKACVSEVNSFTAAFLFSIETQTTI>G<YGFRCVTDECPIAVFMVVFQSIVGCIIDAF174
KCNJ1--SANHTPCVENINGLTSAFLFSLETQVTI>G<YGFRCVTEQCATAIFLLIFQSILGVIINSF173
KCNJ3---GNYTPCVANVYNFPSAFLFFIETEATI>G<YGYRYITDKCPEGIILFLFQSILGSIVDAF175
KCNJ4AAPVAPKPCIMHVNGFLGAFLFSVETQTTI>G<YGFRCVTEECPLAVIAVVVQSIVGCVIDSF166
KCNJ5---QEWIPCVENLSGFVSAFLFSIETETTI>G<YGFRVITEKCPEGIILLLVQAILGSIVNAF181
KCNJ6---PSWTPCVTNLNGFVSAFLFSIETETTI>G<YGYRVITDKCPEGIILLLIQSVLGSIVNAF184
KCNJ8KSGLESTVCVTNVRSFTSAFLFSIEVQVTI>G<FGGRMMTEECPLAITVLILQNIVGLIINAV172
KCNJ9---TAWTPCVNNLNGFVAAFLFSIETETTI>G<YGHRVITDQCPEGIVLLLLQAILGSMVNAF152
KCNJ10--PANHTPCVVQVHTLTGAFLFSLESQTTI>G<YGFRYISEECPLAIVLLIAQLVLTTILEIF160
KCNJ11-GTA--EPCVTSIHSFSSAFLFSIEVQVTI>G<FGGRMVTEECPLAILILIVQNIVGLMINAI162
KCNJ12---RGRTPCVMQVHGFMAAFLFSIETQTTI>G<YGLRCVTEECPVAVFMVVAQSIVGCIIDSF175
KCNJ13--PENHTICVKYITSFTAAFSFSLETQLTI>G<YGTMFPSGDCPSAIALLAIQMLLGLMLEAF151
KCNJ14----PPAPCFSHVASFLAAFLFALETQTSI>G<YGVRSVTEECPAAVAAVVLQCIAGCVLDAF179
KCNJ15--ISNHTPCIMKVDSLTGAFLFSLESQTTI>G<YGVRSITEECPHAIFLLVAQLVITTLIEIF159
KCNJ16----DITPCVDNVHSFTGAFLFSLETQTTI>G<YGYRCVTEECSVAVLMVILQSILSCIINTF163
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNJ2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G144Ac.431G>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Electrocardiographic features in Andersen-Tawil syndrome patients with KCNJ2 mutations: characteristic T-U-wave patterns predict the KCNJ2 genotype. Circulation. 2005 111(21):2720-6. 15911703
Inherited ArrhythmiaLQTS Trafficking-competent and trafficking-defective KCNJ2 mutations in Andersen syndrome. Hum Mutat. 2006 27(4):388. 16541386
p.G144Dc.431G>A Inherited ArrhythmiaLQTS,CPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Andersen cardiodysrhythmic periodic paralysis with KCNJ2 mutations: a novel mutation in the pore selectivity filter residue. J Child Neurol. 2010 25(4):490-3. 20382953
Inherited ArrhythmiaCPVT Genetic background of catecholaminergic polymorphic ventricular tachycardia in Japan. Circ J. 2013 77(7):1705-13. 23595086
Inherited ArrhythmiaLQTS New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.G144Sc.430G>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Mutations in Kir2.1 cause the developmental and episodic electrical phenotypes of Andersen's syndrome. Cell. 2001 105(4):511-9. 11371347
Inherited ArrhythmiaLQTS Functional and clinical characterization of KCNJ2 mutations associated with LQT7 (Andersen syndrome). J Clin Invest. 2002 110(3):381-8. 12163457
Inherited ArrhythmiaLQTS Additional gene variants reduce effectiveness of beta-blockers in the LQT1 form of long QT syndrome. J Cardiovasc Electrophysiol. 2004 15(2):190-9. 15028050
Inherited ArrhythmiaLQTS Genotype-phenotype correlations of KCNJ2 mutations in Japanese patients with Andersen-Tawil syndrome. Hum Mutat. 2007 28(2):208. 17221872
Inherited ArrhythmiaLQTS Altered stress stimulation of inward rectifier potassium channels in Andersen-Tawil syndrome. FASEB J. 2012 26(2):513-22. 22002906
Inherited ArrhythmiaLQTS Andersen mutations of KCNJ2 suppress the native inward rectifier current IK1 in a dominant-negative fashion. Cardiovasc Res. 2003 59(2):321-7. 12909315
Inherited ArrhythmiaLQTS Defective potassium channel Kir2.1 trafficking underlies Andersen-Tawil syndrome. J Biol Chem. 2003 278(51):51779-85. 14522976