Paralogue Annotation for RYR1 residue 1000

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1000
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1000

No paralogue variants have been mapped to residue 1000 for RYR1.



RYR1DLSHVRLTPAQTTLVDRLAENGHNVWARDR>V<GQGWSYSAVQDIPARRNPRLVPYRLLDEAT1030
RYR2DLSFIKLTPSQEAMVDKLAENAHNVWARDR>I<RQGWTYGIQQDVKNRRNPRLVPYTLLDDRT1042
RYR3DLSDVKLLPPQEILVDKLAENAHNVWAKDR>I<KQGWTYGIQQDLKNKRNPRLVPYALLDERT1029
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V1000Mc.2998G>A Putative BenignSIFT:
Polyphen: probably damaging