Paralogue Annotation for RYR1 residue 1061

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1061
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1061

No paralogue variants have been mapped to residue 1061 for RYR1.



RYR1RSNRDSLCQAVRTLLGYGYNIEPPDQEP-S>Q<VEN-QSRCDRVRIFRAEKSYTVQSGRWYFE1090
RYR2KSNKDSLREAVRTLLGYGYNLEAPDQDHAA>R<AEVCSGTGERFRIFRAEKTYAVKAGRWYFE1104
RYR3KSNRDSLREAVRTFVGYGYNIEPSDQEL-A>D<SAVEKVSIDKIRFFRVERSYAVRSGKWYFE1090
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q1061Rc.3182A>G Putative BenignSIFT: tolerated
Polyphen: benign