Paralogue Annotation for RYR1 residue 1088

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1088
Reference Amino Acid: Y - Tyrosine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1088

No paralogue variants have been mapped to residue 1088 for RYR1.



RYR1-SQVEN-QSRCDRVRIFRAEKSYTVQSGRW>Y<FEFEAVTTGEMRVGWARPELRPDVELGADE1118
RYR2AARAEVCSGTGERFRIFRAEKTYAVKAGRW>Y<FEFETVTAGDMRVGWSRPGCQPDQELGSDE1132
RYR3-ADSAVEKVSIDKIRFFRVERSYAVRSGKW>Y<FEFEVVTGGDMRVGWARPGCRPDVELGADD1118
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y1088Cc.3263A>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Samaritan myopathy, an ultimately benign congenital myopathy, is caused by a RYR1 mutation. Acta Neuropathol. 2012 124(4):575-81. 22752422