Paralogue Annotation for RYR1 residue 1149

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1149
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1149

No paralogue variants have been mapped to residue 1149 for RYR1.



RYR1LAYVFNGHRGQRWHLGSEPFGRPWQPGDVV>G<CMIDLTENTIIFTLNGEVLMSDSGSETAFR1179
RYR2RAFAFDGFKAQRWHQGNEHYGRSWQAGDVV>G<CMVDMNEHTMMFTLNGEILLDDSGSELAFK1193
RYR3QAFVFEGNRGQRWHQGSGYFGRTWQPGDVV>G<CMINLDDASMIFTLNGELLITNKGSELAFA1179
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1149Dc.3446G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging