Paralogue Annotation for RYR1 residue 116

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 116
Reference Amino Acid: Y - Tyrosine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 116

No paralogue variants have been mapped to residue 116 for RYR1.



RYR1-----SSQGGGHRTLLYGHAILLRHAHSRM>Y<LSCLTTSRSMTDKLAFDVGLQEDATGEACW146
RYR2KFMMKTAQGGGHRTLLYGHAILLRHSYSGM>Y<LCCLSTSRSSTDKLAFDVGLQEDTTGEACW159
RYR3-----AAQGGGHRTLLYGHAVLLRHSFSGM>Y<LTCLTTSRSQTDKLAFDVGLREHATGEACW149
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y116Cc.347A>G Putative BenignSIFT:
Polyphen: probably damaging