Paralogue Annotation for RYR1 residue 1175

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1175
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1175

No paralogue variants have been mapped to residue 1175 for RYR1.



RYR1GDVVGCMIDLTENTIIFTLNGEVLMSDSGS>E<TAFREIEIGDGFLPVCSLGPGQVGHLNLGQ1205
RYR2GDVVGCMVDMNEHTMMFTLNGEILLDDSGS>E<LAFKDFDVGDGFIPVCSLGVAQVGRMNFGK1219
RYR3GDVVGCMINLDDASMIFTLNGELLITNKGS>E<LAFADYEIENGFVPICCLGLSQIGRMNLGT1205
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1175Kc.3523G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Utility of next generation sequencing in genetic diagnosis of early onset neuromuscular disorders. J Med Genet. 2015 52(3):208-16. doi: 10.1136/jmedgenet-2014-102819. 25635128