Paralogue Annotation for RYR1 residue 1176

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1176
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1176

No paralogue variants have been mapped to residue 1176 for RYR1.



RYR1DVVGCMIDLTENTIIFTLNGEVLMSDSGSE>T<AFREIEIGDGFLPVCSLGPGQVGHLNLGQD1206
RYR2DVVGCMVDMNEHTMMFTLNGEILLDDSGSE>L<AFKDFDVGDGFIPVCSLGVAQVGRMNFGKD1220
RYR3DVVGCMINLDDASMIFTLNGELLITNKGSE>L<AFADYEIENGFVPICCLGLSQIGRMNLGTD1206
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1176Ic.3527C>T Putative BenignSIFT: tolerated
Polyphen: benign