Paralogue Annotation for RYR1 residue 1240

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1240
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1240

No paralogue variants have been mapped to residue 1240 for RYR1.



RYR1LRFFAICGLQEGFEPFAINMQRPVTTWFSK>G<LPQFEPVPLEHPHYEVSRVDGTVDTPPCLR1270
RYR2LKYFTICGLQEGYEPFAVNTNRDITMWLSK>R<LPQFLQVPSNHEHIEVTRIDGTIDSSPCLK1284
RYR3FKFYTMCGLQEGFEPFAVNMNRDVAMWFSK>R<LPTFVNVPKDHPHIEVMRIDGTMDSPPCLK1270
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1240Vc.3719G>T UnknownSIFT:
Polyphen: benign