Paralogue Annotation for RYR1 residue 1292

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1292
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1292

No paralogue variants have been mapped to residue 1292 for RYR1.



RYR1TVDTPPCLRLTHRTWGSQNSLVEMLFLRLS>L<PVQFHQHFRCTAGATPLAPPGLQPPAEDEA1322
RYR2TIDSSPCLKVTQKSFGSQNSNTDIMFYRLS>M<PIECAEVFSKTV-AGGLPGAGLFGPK-NDL1334
RYR3TMDSPPCLKVTHKTFGTQNSNADMIYCRLS>M<PVECHSSFSH--------------------1302
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L1292Fc.3874C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging