Paralogue Annotation for RYR1 residue 1330

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1330
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1330

No paralogue variants have been mapped to residue 1330 for RYR1.



RYR1FRCTAGATPLAPPGLQPPAEDEARAAEPDP>D<YENLRRSAGGWSEAENGKEGTAKEGAPGGT1360
RYR2FSKTV-AGGLPGAGLFGPK-NDLEDYDADS>D<FEVLMKTAHGHLVPDRVDKDKEATKPEFNN1372
RYR3FSH--------------------------->-<------------------------------1302
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D1330Ec.3990C>G Putative BenignSIFT: tolerated
Polyphen: benign