Paralogue Annotation for RYR1 residue 1337

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1337
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1337

No paralogue variants have been mapped to residue 1337 for RYR1.



RYR1TPLAPPGLQPPAEDEARAAEPDPDYENLRR>S<AGGWSEAENGKEGTAKEGAPGGTPQAGGEA1367
RYR2GGLPGAGLFGPK-NDLEDYDADSDFEVLMK>T<AHGHLVPDRVDKDKEATKPEFNNHK-----1374
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1337Lc.4010C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging